Oryzias latipes (Japanese medaka): 101159234 Help Entry 101159234         CDS       T02443                                  Symbol mras Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04010   MAPK signaling pathway ola04137   Mitophagy - animal ola04140   Autophagy - animal ola04218   Cellular senescence ola04371   Apelin signaling pathway ola04519   Cadherin signaling ola04625   C-type lectin receptor signaling pathway ola04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ola00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101159234 (mras)    04371 Apelin signaling pathway     101159234 (mras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     101159234 (mras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101159234 (mras)    04137 Mitophagy - animal     101159234 (mras)   09143 Cell growth and death    04218 Cellular senescence     101159234 (mras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101159234 (mras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101159234 (mras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ola04031]     101159234 (mras) GTP-binding proteins [BR:ola04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101159234 (mras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 Motif Other DBs NCBI-GeneID:  101159234 NCBI-ProteinID:  XP_004082041 UniProt:  H2MV62 LinkDB All DBs Position 21:26852367..26872988 Genome browser AA seq 209 aa AA seqDB search MAMSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAFP MVLVANKVDLVHLRKVTAEQGHEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIRQQVP ERNQKKKKKKMKWRAERSTGSHRFHCSIL NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcgatgagcgcagtgccaagtgacaacttgccaacctacaagctggttgtggtgggg gatggaggtgtcggtaaaagtgctttaaccatccagtttttccagaagatctttgtgcca gactatgatcccaccatcgaggactcttaccttaaacacacagagatcgatggacagtgg gccatacttgatgtgctggacacggcaggccaggaggagttcagcgccatgagggagcag tacatgaggacgggggacggcttcctcatcgtcttttccgtcacggacaaggccagcttt gagcacgtggaccggttccatcagctcatcctgcgggtcaaagacagagaggccttcccc atggtgctggtggctaacaaggtggacttggtgcatttacgaaaggtcaccgcagagcag ggccacgagatggctgcaaaacacaacataacctacattgaaaccagtgccaaggatcct ccgatgaacgtggacaaagccttccatgaactggtccgagttataaggcaacaggttcca gagcgaaaccagaagaagaagaagaagaagatgaagtggagggcagagcggtccacgggt tcccacaggttccactgctccatcttgtga

DBGET integrated database retrieval system