Oryzias latipes (Japanese medaka): 101161532 Help Entry 101161532         CDS       T02443                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism ola  Oryzias latipes (Japanese medaka) Pathway ola03082   ATP-dependent chromatin remodeling ola04217   Necroptosis Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101161532  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101161532  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ola03036]     101161532   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101161532 Chromosome and associated proteins [BR:ola03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101161532 Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101161532 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101161532 NCBI-ProteinID:  XP_004065541 UniProt:  A0A3P9MNP7 LinkDB All DBs Position 1:2176268..2176729 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggaaagaccggcggaaaagcccgtgccaaggcaaagacccgctcctcc cgcgctggtctgcagttccccgtgggtcgtgtccacagactgctgcgcaaaggcaactat gcggagcgtgtgggagccggagcccccgtgtacctggccgccgtgctggagtatctgacc gctgagatcctggagctggccggaaacgccgcccgcgacaacaagaagaccaggatcatc ccccgtcacctgcagctggctgtccgcaacgacgaggagctcaacaagctgctgggcgga gtcaccatcgctcagggcggcgtgctgcccaacatccaggcggttctgctgcccaagaag accgagaagcccgccaagaccaagtag

DBGET integrated database retrieval system