Oryzias latipes (Japanese medaka): 101163934 Help Entry 101163934         CDS       T02443                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism ola  Oryzias latipes (Japanese medaka) Brite KEGG Orthology (KO) [BR:ola00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ola01002]     101163934   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101163934 Peptidases and inhibitors [BR:ola01002]  Peptidase inhibitors   Family I25: cystatin family    101163934 Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101163934 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light DUF7918 SQAPI Motif Other DBs NCBI-GeneID:  101163934 NCBI-ProteinID:  XP_004081114 UniProt:  H2LZM2 A0A3P9KW25 LinkDB All DBs Position 20:complement(17841872..17843248) Genome browser AA seq 99 aa AA seqDB search MPMRGGLTDVKEADASVQQICDQVKAHVEQKAGANFGVFTAKSYKTQVVAGTNYFIKVHV GGDDYVHVRIWQKLPCYGGELELANIQHPKTHSEPIEYF NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgatgcgtggaggactcaccgacgtcaaagaagctgatgccagcgtccagcagatc tgcgatcaagtgaaagctcacgtggagcaaaaggcaggagcaaattttggcgtttttacc gcgaagagctacaagacgcaagttgtggccggaaccaattattttataaaggtccatgtg ggaggagatgattatgtgcacgttcggatttggcagaaactcccctgctatggtggagaa ctcgagctggctaacattcaacaccccaagacccacagcgaacccatcgagtacttctaa

DBGET integrated database retrieval system