Oryzias latipes (Japanese medaka): 101165278 Help Entry 101165278         CDS       T02443                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04010   MAPK signaling pathway ola04012   ErbB signaling pathway ola04068   FoxO signaling pathway ola04137   Mitophagy - animal ola04140   Autophagy - animal ola04144   Endocytosis ola04150   mTOR signaling pathway ola04210   Apoptosis ola04218   Cellular senescence ola04370   VEGF signaling pathway ola04371   Apelin signaling pathway ola04510   Focal adhesion ola04540   Gap junction ola04625   C-type lectin receptor signaling pathway ola04810   Regulation of actin cytoskeleton ola04910   Insulin signaling pathway ola04912   GnRH signaling pathway ola04916   Melanogenesis ola05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ola00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101165278 (hras)    04012 ErbB signaling pathway     101165278 (hras)    04370 VEGF signaling pathway     101165278 (hras)    04371 Apelin signaling pathway     101165278 (hras)    04068 FoxO signaling pathway     101165278 (hras)    04150 mTOR signaling pathway     101165278 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101165278 (hras)    04140 Autophagy - animal     101165278 (hras)    04137 Mitophagy - animal     101165278 (hras)   09143 Cell growth and death    04210 Apoptosis     101165278 (hras)    04218 Cellular senescence     101165278 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101165278 (hras)    04540 Gap junction     101165278 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101165278 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101165278 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     101165278 (hras)    04912 GnRH signaling pathway     101165278 (hras)    04916 Melanogenesis     101165278 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101165278 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ola04131]     101165278 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101165278 (hras)    04031 GTP-binding proteins [BR:ola04031]     101165278 (hras) Membrane trafficking [BR:ola04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101165278 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     101165278 (hras) Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101165278 (hras)   Exosomal proteins of colorectal cancer cells    101165278 (hras) GTP-binding proteins [BR:ola04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101165278 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  101165278 NCBI-ProteinID:  XP_023811965 UniProt:  A0A3P9LYY6 LinkDB All DBs Position 6:complement(32105640..32116129) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PVRTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDSGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggttggagccggaggtgtggggaagagcgcgctcacc atccagctcatccagaaccactttgttgacgaatacgaccccactatagaggactcctac cggaagcaggtggtgatcgacggcgagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgcgggaccagtacatgcggacgggggagggcttcctctgc gtctttgccatcaacaacaccaagtcttttgaggacatccaccagtacagggagcagatc aagcgggtgaaggactctgacgacgtccccatggtgctggtggggaacaagtgtgacctt ccggtgcgcacggtagaaacccggcaagcccaggaattggcccggtcctacggtatccct tacatcgagacctctgctaaaacccggcagggggtggaagatgctttctacactctggtc agggagatccggcaacataagctacggaagctgaacccccccgatgacagcggtcaggac tgcatgagctgtcgctgcgtggtctcctga

DBGET integrated database retrieval system