Oryzias latipes (Japanese medaka): 101165723 Help Entry 101165723         CDS       T02443                                  Name (RefSeq) ADP-ribosylation factor 6-like   KO K07941   ADP-ribosylation factor 6 Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04144   Endocytosis ola05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ola00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101165723  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101165723  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ola04131]     101165723   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101165723    04031 GTP-binding proteins [BR:ola04031]     101165723 Membrane trafficking [BR:ola04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     101165723   Arf GTPases and associated proteins    Arf GTPases     101165723 Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101165723   Exosomal proteins of colorectal cancer cells    101165723 GTP-binding proteins [BR:ola04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     101165723 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 6PF2K Motif Other DBs NCBI-GeneID:  101165723 NCBI-ProteinID:  XP_011473220 LinkDB All DBs Position 5:12011950..12012591 Genome browser AA seq 109 aa AA seqDB search MGKMLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELQPHQFI NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggggaaaatgctctctaaaatcttcggcaacaaggagatgagaatattgatgcttgga cttgatgctgcaggaaagacaacaatcctatacaagctaaaacttggacagtccgtgacc acaatccctacagtaggcttcaacgtggaaacggtcacctacaagaatgtcaagttcaac gtgtgggacgtcggaggccaagataaaattcgccctctatggcggcactactacacgggc acccagggcttgatattcgtggtggattgtgcggacagggatcggatcgatgaggcgagg caggaacttcaaccccatcaattcatctga

DBGET integrated database retrieval system