KEGG Orthology (KO) [BR:ola00001]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:ola03029]
101167044 (gfer)
Enzymes [BR:ola01000]
1. Oxidoreductases
1.8 Acting on a sulfur group of donors
1.8.3 With oxygen as acceptor
1.8.3.2 thiol oxidase
101167044 (gfer)
Mitochondrial biogenesis [BR:ola03029]
Mitochondrial protein import machinery
Inter membrane space
Mitochondrial intermembrane space assembly (MIA) complex
101167044 (gfer)
175 aa
MAAPPDSRQPSVPNLKEQEQSRDGKKKPCRTCTDFKSWMKQQKQQSVALHHESQAAEVEH
QDPQCPLDREELGRNSWSLLHTMAAYYPDQPSSTQQQEMKQFINLFSHFYPCEDCAEDLR
NRLKTNQPETSNRSTLSQWLCHLHNDVNARLGKPEFDCSRVDERWKDGWKDGSCD