Oryzias latipes (Japanese medaka): 101171580 Help Entry 101171580         CDS       T02443                                  Name (RefSeq) elongin-B-like isoform X4   KO K03873   elongin-B Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     101171580  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ola04121]     101171580    03400 DNA repair and recombination proteins [BR:ola03400]     101171580 Ubiquitin system [BR:ola04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      101171580    Cul5 complex      101171580 DNA repair and recombination proteins [BR:ola03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      101171580 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  101171580 NCBI-ProteinID:  XP_004071224 LinkDB All DBs Position 8:complement(3917507..3925780) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKKPPEDQRLYKDDVLLNDTQTLGNC GFTNQTARPQAPATVGLAFRLGDDSFEQLRIESFSTPPELPDVMKPQDSGSTANEQAIQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttttaatgatcagacgtcacaagacgaccatcttcacagatgccaaagag tctaccacagtctatgaactgaagcgcattgtggaaggcattttgaaaaagccacctgaa gatcagagactatataaggatgacgtgctgcttaatgacactcagactcttggaaattgt ggcttcacgaatcaaacagcacgacctcaagccccggcgacagtgggtttagcctttcgt ctgggtgacgactcatttgagcagctgaggatcgagtcattttccaccccgcctgagctt cctgatgtcatgaaaccccaagattcaggcagcacagccaacgagcaggccatccagtga

DBGET integrated database retrieval system