Oryzias latipes (Japanese medaka): 101172142 Help Entry 101172142         CDS       T02443                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ola  Oryzias latipes (Japanese medaka) Pathway ola03030   DNA replication ola03082   ATP-dependent chromatin remodeling ola03410   Base excision repair ola03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101172142 (pole3)    03410 Base excision repair     101172142 (pole3)    03420 Nucleotide excision repair     101172142 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101172142 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ola03032]     101172142 (pole3)    03036 Chromosome and associated proteins [BR:ola03036]     101172142 (pole3)    03400 DNA repair and recombination proteins [BR:ola03400]     101172142 (pole3) Enzymes [BR:ola01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101172142 (pole3) DNA replication proteins [BR:ola03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101172142 (pole3) Chromosome and associated proteins [BR:ola03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     101172142 (pole3) DNA repair and recombination proteins [BR:ola03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101172142 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C SpoU_methylase DUF4746 CIS_TMP Afi1 RNA_pol_3_Rpc31 Zip Motif Other DBs NCBI-GeneID:  101172142 NCBI-ProteinID:  XP_004066863 UniProt:  A0A3P9LN52 H2L4L3 LinkDB All DBs Position 3:complement(5686431..5688799) Genome browser AA seq 148 aa AA seqDB search MAEKPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFALKAK RKTLNAADVLAAMEEMEFERFLEPLRAALEVYKKGQKGKKEVSEQKRKEKEKKADCEHEK SKEDEEGEDEEEQRMEEETEEGEEEVEN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggccgagaaaccggaggatctgaaccttcctaacgcggtcatcacgcgcatcatcaag gaggcgcttccagatggggtgaacgtatccaaagaggcgcgcagagccatttcccaggcc gccagcgtctttgtgctgtatgcaacctcctgtgccaataactttgcactgaaggccaaa cggaagactttaaatgctgcagatgtgctggcagcgatggaggagatggagttcgaacgc ttcctggagcctctcagagcggctctagaagtctacaagaaaggtcagaagggaaagaag gaagtgtctgagcagaaacgcaaagaaaaagagaagaaggcagactgtgagcatgaaaag agcaaggaagatgaggagggagaggatgaggaagaacaacgcatggaggaggagaccgag gagggggaagaggaggtggagaactga

DBGET integrated database retrieval system