Oryzias latipes (Japanese medaka): 101173415 Help Entry 101173415         CDS       T02443                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04621   NOD-like receptor signaling pathway ola05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ola00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101173415 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101173415 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ola03110]     101173415 (txn) Chaperones and folding catalysts [BR:ola03110]  Protein folding catalysts   Protein disulfide isomerase    101173415 (txn) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin AhpC-TSA Thioredoxin_8 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Redoxin Thioredoxin_9 PedC-like DIM1 A6-like_Thioredoxin-like_C Motif Other DBs NCBI-GeneID:  101173415 NCBI-ProteinID:  XP_004079889 LinkDB All DBs Position 18:complement(18249684..18253126) Genome browser AA seq 107 aa AA seqDB search MVREVADLAEFKKILEDAGDKLVVVDFTASWCGPCKQIAPLYKQMSESDDNKNVVFLKVD VDEADDISSFCEIKCMPTFHFYKGGKKVDEFSGANVATLEEKLKALR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggtccgtgaagtggctgatcttgcagaattcaagaaaattctggaagacgctggagac aagctggtggttgtggactttactgcatcatggtgtgggccctgcaaacagattgccccc ttgtacaagcaaatgtcggaaagcgatgacaacaagaatgtggttttcctgaaggtggat gtggacgaggctgatgatatcagcagtttctgtgaaattaaatgcatgcctacattccac ttctacaaggggggcaaaaaggtggatgagttctctggtgccaacgttgcaaccctggag gaaaagctgaaagcactgagatag

DBGET integrated database retrieval system