KEGG   Horticoccus luteus: K0B96_06190
Entry
K0B96_06190       CDS       T07405                                 
Name
(GenBank) ATP-dependent Clp protease adaptor ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
ole  Horticoccus luteus
Brite
KEGG Orthology (KO) [BR:ole00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    K0B96_06190
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: QYM80202
UniProt: A0A8F9TYA2
LinkDB
Position
1491719..1492024
AA seq 101 aa
MISAETKTTPSPSAHTETETALAGLWRVVVLNDPVNLMSYVVLVFKKVLGFDESTARRHM
LEVHELGRSVVWTGVREKAEAYVYTLQQWHLTVILERDETH
NT seq 306 nt   +upstreamnt  +downstreamnt
atgatttctgccgagacgaaaacgacgcccagcccgagcgcacacaccgaaaccgagacg
gcactggccggcttgtggcgcgtggtcgtgctcaacgatccggtgaacttgatgtcgtat
gtcgtgctcgtgtttaaaaaggttctgggtttcgacgaatcgacggcgcggcggcacatg
ctggaggtgcacgaactcggccgctcagtggtgtggacgggggtgcgcgagaaggcggag
gcttacgtctacacgttgcagcaatggcacctgacggtgatcttggagcgcgatgaaacg
cattga

DBGET integrated database retrieval system