KEGG   Horticoccus luteus: K0B96_07130
Entry
K0B96_07130       CDS       T07405                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
ole  Horticoccus luteus
Brite
KEGG Orthology (KO) [BR:ole00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ole03016]
    K0B96_07130 (truB)
Enzymes [BR:ole01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     K0B96_07130 (truB)
Transfer RNA biogenesis [BR:ole03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    K0B96_07130 (truB)
 Prokaryotic type
    K0B96_07130 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 DKCLD
Other DBs
NCBI-ProteinID: QYM80373
UniProt: A0A8F9TZ19
LinkDB
Position
1716444..1717172
AA seq 242 aa
MLGQPKKEYDGVLLVDKPTDHTSHDVVARIRRKFNQKRVGHAGTLDPMATGLLIMLIGKA
TRASQFLMGLGKEYEGTIELGKVTNTQDAEGEVVATRPVPALTEADVRTAMASFLGDQYQ
TPPMFSAIKIDGVALHKLARKGEEVEREPRFIRVQSFELLRFAPPQFDFRIRCSKGTYVR
TIAHDLGHKIGCGGHLAALRRTAVDKFQVADALTMDQIEAMPLPELEKRLLAVHNVVPTV
AL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgctcgggcaacccaagaaggaatacgatggcgtcttgttggtcgacaaaccaacggat
cacacctcgcacgacgtcgtcgcgcgaattcgccgcaaatttaaccagaagcgcgtcggc
cacgctggcacgctcgatccgatggccacggggttgctgattatgctgattggcaaggcg
acccgggcatcgcagttcctgatggggctggggaaggaatacgaaggcacgatcgagctc
ggcaaagtgaccaacacgcaggatgccgagggtgaagtcgtcgccacgcggccggtgccg
gcgttgactgaagccgacgtgcgcaccgcgatggcgtcgtttctcggggatcagtatcag
acgccgccgatgttttccgccatcaagatcgatggcgtggccctgcacaaactggcgcgc
aaaggtgaagaggtggaacgggagccgcgctttattcgcgtgcaaagcttcgaactcctg
cgtttcgcgccgccgcagttcgattttcgcattcgctgcagcaagggcacgtatgtgcgg
acgattgcccacgatttggggcacaagatcggttgcggcggacatctggccgcgctccgt
cggacggcggtcgataaatttcaagtggccgatgcgctgacgatggaccagattgaggca
atgccgttgcccgagttggaaaagcgcttgttggcagtgcacaacgtcgtgcccacggtg
gcgctgtga

DBGET integrated database retrieval system