Horticoccus luteus: K0B96_08430 Help Entry K0B96_08430       CDS       T07405                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ole  Horticoccus luteus Pathway ole01100   Metabolic pathways ole01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ole00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0B96_08430    00074 Mycolic acid biosynthesis     K0B96_08430   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0B96_08430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1411 Motif Other DBs NCBI-ProteinID:  QYM80613 UniProt:  A0A8F9TZI2 LinkDB All DBs Position complement(2005839..2006099) Genome browser AA seq 86 aa AA seqDB search MTTDECKQVVLDIIADIAPDEDLSNVKPDVRLRDQLQLDSMDFLDIVMELRKRHGIEVPE ADYQQLASLDSSAAYLTPKFNAQKQG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccaccgacgaatgcaagcaggtcgtgctcgatatcatcgcggacatcgcgcccgat gaagacctttcgaatgtgaaaccggacgtgcgcctgcgcgaccaactccagctcgatagc atggactttctcgacatcgtgatggagctgcgcaaacgccacggcatcgaggtgccggag gcggattaccagcaactggcctcactcgacagttccgcggcgtatcttacgccgaagttc aacgcccagaagcagggctga

DBGET integrated database retrieval system