Horticoccus luteus: K0B96_11455
Help
Entry
K0B96_11455 CDS
T07405
Name
(GenBank) response regulator
Organism
ole
Horticoccus luteus
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
HATPase_c
SBP_bac_3
PAS_3
HisKA
PAS
PAS_9
PAS_4
Receiver_CRE1
AOC_like
PDE8A_N
Motif
Other DBs
NCBI-ProteinID:
QYM77927
UniProt:
A0A8F9TUQ7
LinkDB
All DBs
Position
complement(2801866..2804724)
Genome browser
AA seq
952 aa
AA seq
DB search
MRYLYLCFLLLVFPALLGAAAPLRIGVENNSDPLSYVDANGHLTGFTADFLAALENTGRV
DFEIVPGSWAHVLEEFQAGRLDALANVTIREERRKEMDFSIGHAFVHGVAYFRPDSPHVH
RTAEFAGKRIAVLSGSIGHTNAMEHGGWGATIVAYPTWPAALKSVQDGQTDFALFIRSYR
RAGNDPFSRFEMEYIDDVIHEYRVAVHKGDARSLERINDAIATVRSNGVFDRIYAKWIGP
LEPHPIRLADLRPYVLPGGLALAAIVAIFWWQRMMLKRLARRSEALRVSEERWGFAIEGA
GDAVIDVDIKTGAAVLSPRWAQMLGYAPEELGATLQEWMGRIHPDDAPAMQVALHEHMAG
RTRSCVNEHRLRRKDGSYLWVLSRSLVVRRDPSGNPVRLIGTTSDITERKQSEKALRDAR
AAAEESARLKSQFLANVSHEIRTPINGVIGAVGLLTDTELTENQRALAAIVGTSAQSLLT
IINDILDFSRIEAGQLVFEATPFDIREPVEGCLELLADRAAAKNLELVYLIDEGMKTRLI
GDAGRLRQVLVNLAGNAVKFTETGEVEVRVRQVAEVGRSVRLRFEVRDTGIGITPEQQGR
LFQPFVQADGSTTRKYGGSGLGLAISRQLVGLMGGELGVESAAGRGSTFWFTAEFEGAEA
DYRDLAAPPAWRSLRALVIDDHERSGEALRRQFSAAGLDCSVAVRGGAGMTALRAAVRAQ
RPFALVAIDMKLSDTTGFDLLRQVRSEPMLAGLKTILLTTIREPLSPEELAASGADRALG
KPVRHRALEEALRALLGREQRENPTPALGRNDAAAGLVKDGPAVRILVAEDNRVNQTVIR
KQLEKFGYDPVLVENGRQAVEAVKAEVFDVVLMDCQMPEMDGIEATRHIRAWEVAQSQSG
SERRPVHIVALTAHAIKGDREQCLAAGMNDYLSKPVRAEDIAAAIQRAPRNS
NT seq
2859 nt
NT seq
+upstream
nt +downstream
nt
atgcgatacctttatttgtgtttcctgttgctcgtgttcccggcgttgctgggggcggct
gcgccgttgcggatcggagtggagaacaactcggatccgctctcgtatgtggatgcgaac
ggacacctgacgggcttcacggcggattttctggcggcgttggaaaacaccgggcgcgtg
gattttgaaatcgtgcccgggtcgtgggcgcacgtgctggaggagtttcaagccggacgg
ctggacgcgctggcgaacgtcacgatccgggaagaacggcgcaaggagatggatttttcc
attgggcacgcgttcgtgcatggcgtggcgtatttccggccggacagcccgcacgtgcat
cggacggcggagtttgccggcaagcggatcgcggtgctgtcgggcagcatcgggcacacg
aacgcgatggagcatggcggctggggcgcgacgatcgtggcgtatcccacctggcccgcg
gcgttgaaatcggtgcaagacggccagacggatttcgcgttgttcatccgcagctaccgg
cgggcgggcaatgatccgttctcccggttcgagatggaatacatcgacgacgtcatccac
gaataccgggtcgcggtgcacaaaggcgatgcccgcagtctggagcggatcaacgacgcg
atcgccaccgtgcgcagcaacggcgtcttcgatcgcatttatgcgaagtggatcgggccg
ctggagccgcatccgatccggctggcggacttgcggccgtatgtgctgccgggcgggctc
gcgctggcggcgatcgtggcgatcttctggtggcagcggatgatgttgaagcggctggcg
cggcggagcgaggcgttgcgcgtgagcgaggagcggtgggggtttgccatcgagggagcc
ggggacgcggtcatcgacgtggacatcaaaacgggcgcagcggtgctctcgccgcggtgg
gcgcagatgctgggttacgcgccggaggaattgggggcgacattgcaggaatggatggga
cgcatccatccggacgatgcgccggcgatgcaggtggcgttgcacgaacacatggcgggg
cgcacgcgcagctgcgtgaacgaacaccggttgcggcgcaaggacggcagctatctgtgg
gtgttgagccggagtctggtcgtgcgccgcgatccgagcggaaacccggtgcggttgatc
ggcacgacgtcggacatcacggagcgcaagcagagtgaaaaggcgttgcgcgatgcgcgg
gcggcggcggaggaatcggcgcggttgaagtcgcagtttctggccaacgtgagccacgaa
atccggacgccgatcaacggcgtgatcggggccgtggggttgttgacggacacggaattg
acggagaatcagcgggcgctcgcggcgatcgtcggcacgagcgcgcaatcgctgctcacg
atcatcaacgacatcctggatttctcgcgcatcgaggcagggcagctcgtgtttgaggcg
acaccgttcgacattcgtgaaccggtggaaggctgcctcgaattgctggcggatcgcgcg
gccgcaaagaatctggagctggtttacctgatcgacgaaggcatgaagacgcggctgatc
ggcgatgcgggccgcctgcgccaggtgctggtgaacctcgccggcaacgcggtgaaattt
accgaaacgggagaagtggaagtgcgcgtgcggcaggtggcggaagtggggcggagcgtg
cggctgcgcttcgaagtgcgggatacgggcatcggaattacgcccgagcagcaggggcgg
ttgtttcagccgttcgtgcaggcggatggcagcacgacgcggaaatacggcgggtccggg
ctggggctggcgatttcgcggcaactggtgggcttgatgggcggcgagctcggcgtggaa
agcgcggcggggcgcgggtcgacgttttggttcacggccgagtttgaaggggcggaggcg
gattaccgggacctcgcggcgccgccggcgtggcgctcgctccgggcgctggtgatcgac
gatcacgagcggagcggcgaggcgttgcggcggcaattttcggcggcgggactcgattgc
tcggtggcggttcgcggcggggcggggatgacggcgttacgcgcggcggtgcgcgcgcag
cggccattcgcgctcgtggcgatcgacatgaagttgtccgacaccacggggttcgatctg
ctgcggcaggtccggtcggagccgatgctcgcgggactgaaaacgattctcctcaccacg
attcgcgagccgctctcgccggaggaactggcggcgtcgggcgcggatcgcgcgctggga
aagccagtgcggcaccgcgcgctggaggaagcgctgcgcgcgttgctggggcgggagcag
cgggaaaacccgacgcccgccctcggccggaacgatgcggcggcaggtctggtgaaggac
ggcccggcggtgcgcattctcgtggcggaagacaatcgcgtgaatcaaaccgtgatccgc
aagcagctggagaaattcggctacgacccggtgctggtggagaacggcagacaggcggtc
gaggccgtgaaggcggaggtgtttgatgtcgtcctgatggattgccagatgccggaaatg
gatggcatcgaggcgacgcggcacattcgcgcgtgggaggtcgcgcagagccagagtggc
tcagagcgccggccggtgcatatcgtggcgttgacggcgcacgcgatcaaaggagaccgc
gagcaatgtctcgcggcggggatgaacgattatctttcgaagcccgtgcgagcggaagac
atcgcggcggcgatccaacgagcgccgcggaacagttga
DBGET
integrated database retrieval system