Horticoccus luteus: K0B96_12580 Help Entry K0B96_12580       CDS       T07405                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism ole  Horticoccus luteus Pathway ole00790   Folate biosynthesis ole01100   Metabolic pathways Module ole_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:ole00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     K0B96_12580 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ole03016]     K0B96_12580 (queF) Enzymes [BR:ole01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      K0B96_12580 (queF) Transfer RNA biogenesis [BR:ole03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     K0B96_12580 (queF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF QueF_N GTP_cyclohydroI Motif Other DBs NCBI-ProteinID:  QYM78142 UniProt:  A0A8F9XFI8 LinkDB All DBs Position complement(3066183..3066557) Genome browser AA seq 124 aa AA seqDB search MADPKLLETFANPAPQRDYVIEHTHHEFTSLCPMTGHPDFADITVRYVADKSCVELKSLK LYFHAFRNEGIFFEAATNKICDDLGRALRPRELTIIADWKARGGFSSRVTASWNAKKTPG RSRK NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggccgatcccaagctgctcgaaacttttgccaatccggctccgcaacgcgactacgtg attgagcacacgcatcacgagttcacctcgctttgcccgatgacgggccaccccgacttc gcggacatcacggtgcgctacgtggcggacaagagctgcgtggagctcaagtcgctcaag ctgtatttccacgcgtttcgcaacgaggggatcttcttcgaggcggcgacgaacaagatt tgcgacgatttgggccgcgcgttgcggccgcgggaactgacgatcatcgcggactggaaa gcgcgcggtgggttcagttcgcgggtcacggcgagttggaacgcgaaaaaaacgcccgga cgttcgcggaagtaa

DBGET integrated database retrieval system