Olivibacter sp. LS-1: FKG96_07405 Help Entry FKG96_07405       CDS       T06195                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism oli  Olivibacter sp. LS-1 Brite KEGG Orthology (KO) [BR:oli00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oli03032]     FKG96_07405    03036 Chromosome and associated proteins [BR:oli03036]     FKG96_07405    03400 DNA repair and recombination proteins [BR:oli03400]     FKG96_07405 DNA replication proteins [BR:oli03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FKG96_07405 Chromosome and associated proteins [BR:oli03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FKG96_07405 DNA repair and recombination proteins [BR:oli03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FKG96_07405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-DNA_bdg HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QEL00644 UniProt:  A0A5C0ZHV5 LinkDB All DBs Position 1868744..1869034 Genome browser AA seq 96 aa AA seqDB search MNKADLITKIAADAGITKVQAEKALSSITNSVTTTLKKGESVSLIGFGTFTVGQRAARSG RNPNTGAVIKIKATKVPKFRPGKSLREAVASAKTKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagctgatcttatcacaaagattgccgcagatgcgggcattacaaaagttcag gcagaaaaagcgctgagcagtatcactaattcggttactacaaccttgaaaaaaggcgag agcgtgtcgttgataggcttcggaacctttacagtgggccagcgtgccgcccgtagtgga cgtaaccccaacactggagccgtcattaaaataaaggctaccaaggtccctaaatttaga cccggtaagtcacttcgcgaagccgtagcctcagcaaaaacaaaaaaatag

DBGET integrated database retrieval system