Olleya sp. Bg11-27: CW732_03410 Help Entry CW732_03410       CDS       T05214                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism oll  Olleya sp. Bg11-27 Pathway oll00190   Oxidative phosphorylation oll01100   Metabolic pathways Module oll_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:oll00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CW732_03410 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:oll00194]     CW732_03410 (atpE) Photosynthesis proteins [BR:oll00194]  Photosystem and electron transport system   F-type ATPase [OT]    CW732_03410 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AUC74774 UniProt:  A0A2K8WVR8 LinkDB All DBs Position 784694..784882 Genome browser AA seq 62 aa AA seqDB search MYNLIGAGLIVIGGGIGLGQIGGKAMEGIARQPEAAGKIQTAMIIIGALLEGLAFGALIL GA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgtacaatttaattggagcaggattaatcgtaatcggtggaggaatcggattaggtcaa attggaggaaaagcaatggaaggtattgctcgtcaacctgaagcagctggaaaaattcaa actgcaatgatcattatcggagccttattagaaggtttagcattcggtgcgttaatctta ggagcataa

DBGET integrated database retrieval system