Olleya sp. Bg11-27: CW732_17990
Help
Entry
CW732_17990 CDS
T05214
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
oll
Olleya sp. Bg11-27
Pathway
oll03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
oll00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
CW732_17990
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
oll03011
]
CW732_17990
Ribosome [BR:
oll03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
CW732_17990
Bacteria
CW732_17990
Archaea
CW732_17990
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DUF6383
TrkA_C
Motif
Other DBs
NCBI-ProteinID:
AUC77463
LinkDB
All DBs
Position
complement(4022181..4022534)
Genome browser
AA seq
117 aa
AA seq
DB search
MALTKNERRLRIKNRIRKVVSGTEARPRLAVFRSNKEIYAQIVDDVNGKTLVASSSRDKD
IAAKGNKVEVATLVGKSIAEKALKAGVATIAFDRGGYLYHGRIKSLAEGAREGGLKF
NT seq
354 nt
NT seq
+upstream
nt +downstream
nt
atggcgttaacaaaaaacgaaagacgattaagaattaaaaacagaatccgtaaggttgtt
tctggtacagaagcaagaccaagattagctgtttttagaagtaataaagaaatttatgct
caaattgtagatgacgttaatggtaaaacattagtcgcttcatcttctagagataaagat
attgctgcaaaaggaaacaaggtagaagtagctacgttagtaggtaagtctatcgcagaa
aaagccttaaaggctggtgttgcaactatcgcttttgatagaggtggttatttatatcat
ggtagaatcaaatcattagctgaaggagctagagaaggcggacttaaattctaa
DBGET
integrated database retrieval system