Olsenella sp. oral taxon 807: ADJ70_02240 Help Entry ADJ70_02240       CDS       T04016                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism olo  Olsenella sp. oral taxon 807 Pathway olo03060   Protein export olo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:olo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ADJ70_02240  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ADJ70_02240  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:olo02044]     ADJ70_02240 Secretion system [BR:olo02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    ADJ70_02240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Zn_Ribbon_1 DUF7577 DZR TackOD1 Zn_ribbon_15 DUF2321 DZR_2 Zn_ribbon_6 Zn_ribbon_3 DUF1258 Zn_ribbon_RanBP Prok-RING_1 DUF1656 Motif Other DBs NCBI-ProteinID:  AKT48055 UniProt:  A0A0K1F093 LinkDB All DBs Position complement(2123889..2124197) Genome browser AA seq 102 aa AA seqDB search MSIFGMGVPELLVILAIALLLFGPKNLPKLGKSLGATVKSIREGMDEGEGKAKDTDVTDV SDTVEEESADSDDVVFCNKCGAKNVAGSEYCNKCGSKIEQAQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcaatctttggcatgggcgttccagagctcctcgttatcttggccattgccctcctt ctcttcggacccaagaacctcccgaaactgggcaagtcattgggggcaacggtcaagagc atccgcgagggtatggacgagggtgagggtaaggccaaggacaccgatgtcaccgacgtg agcgacaccgtcgaggaggagtccgccgactcggacgacgtggtcttctgcaacaagtgc ggcgccaagaacgtcgctggctcagagtactgcaacaagtgcggctccaagatcgagcag gctcagtag

DBGET integrated database retrieval system