Ostreococcus lucimarinus: OSTLU_10510 Help Entry OSTLU_10510       CDS       T01029                                  Name (RefSeq) predicted protein   KO K14404   cleavage and polyadenylation specificity factor subunit 4 Organism olu  Ostreococcus lucimarinus Pathway olu03015   mRNA surveillance pathway Brite KEGG Orthology (KO) [BR:olu00001]  09120 Genetic Information Processing   09122 Translation    03015 mRNA surveillance pathway     OSTLU_10510  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:olu03021]     OSTLU_10510    03019 Messenger RNA biogenesis [BR:olu03019]     OSTLU_10510 Transcription machinery [BR:olu03021]  Eukaryotic type   RNA polymerase II system    Other transcription-related factors     Transcription termination factor      OSTLU_10510 Messenger RNA biogenesis [BR:olu03019]  Eukaryotic type   mRNA processing factors    3' end processing     Cleavage and polyadenylation specificity factor (CPSF) complex      OSTLU_10510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-CCCH zf_CCCH_4 Torus zf-CCCH_2 zf-CCCH_3 Nab2-like_zf-CCCH_ zf-CCCH_4 Motif Other DBs NCBI-GeneID:  5001676 NCBI-ProteinID:  XP_001417675 JGI:  10510 UniProt:  A4RX17 LinkDB All DBs Position 5:<106339..>106584 Genome browser AA seq 82 aa AA seqDB search RKNYRQTVCRHWLRNLCMKGNACGFLHQFDKSRMPTCRFFAKYGECKEPDCPYKHSLEDM KDCNMYKLGFCIHGSLCRFRHV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt cgtaaaaactaccgtcaaaccgtgtgcaggcactggctgcgaaacttgtgcatgaagggc aacgcgtgcgggttcctgcaccagttcgacaagtcccgcatgcccacgtgtcggtttttc gcaaagtacggcgagtgcaaggaaccggattgtccgtacaagcactcgttggaggacatg aaggattgcaacatgtacaagctcgggttctgcattcacgggtcgctgtgcaggtttaga cacgtg

DBGET integrated database retrieval system