Ostreococcus lucimarinus: OSTLU_27333 Help Entry OSTLU_27333       CDS       T01029                                  Name (RefSeq) predicted protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism olu  Ostreococcus lucimarinus Pathway olu03060   Protein export olu04141   Protein processing in endoplasmic reticulum olu04145   Phagosome Brite KEGG Orthology (KO) [BR:olu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     OSTLU_27333    04141 Protein processing in endoplasmic reticulum     OSTLU_27333  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     OSTLU_27333  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:olu04131]     OSTLU_27333   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:olu02044]     OSTLU_27333 Membrane trafficking [BR:olu04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     OSTLU_27333 Secretion system [BR:olu02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    OSTLU_27333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  5005388 NCBI-ProteinID:  XP_001421202 JGI:  27333 UniProt:  A4S732 LinkDB All DBs Position 14:86484..86690 Genome browser AA seq 68 aa AA seqDB search MEVADIAVKPVRDFARDSARLVKKCAKPDAREFWKIAARTATGFVIMGFVGFFVKLIFIP INNIILSS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaagtcgccgacatcgccgtcaagcccgtgcgcgacttcgcgcgcgacagcgcgcgg ctggtgaagaagtgcgccaagcccgacgcgcgcgagttctggaagatcgccgcgcgaacg gcgacggggttcgtcatcatgggattcgtgggattcttcgtcaagctcatcttcatcccg atcaacaacatcatcctgagcagctga

DBGET integrated database retrieval system