KEGG   Ostreococcus lucimarinus: OSTLU_31014
Entry
OSTLU_31014       CDS       T01029                                 
Name
(RefSeq) MOP(MATE) family transporter: multidrug efflux
Organism
olu  Ostreococcus lucimarinus
SSDB
Motif
Pfam: MatE MurJ Polysacc_synt_3
Other DBs
NCBI-GeneID: 5001417
NCBI-ProteinID: XP_001417438
JGI: 31014
UniProt: A4RVL2
LinkDB
Position
4:complement(158686..160368)
AA seq 560 aa
MPTARPRATDDATARDARTRARRTILGVDRATGEAIPDWDECAEWRARAPPSAETLELLD
ASIFALALPGVAELLLDPVMGAVDTAFIGRLTGDGAAEALGGLAVSTTCFTFCFKLFNFL
AVVTGPLVAAKISASGGRDSAEGRRAAKKTVGSAMALALALGFATMGIMEVFTDDLLAFC
GASHEALLNPSEDLLPDADVPTIKGMLEYGEDYLRIRAASLPACLIVMVGVGAFRGLLDT
RTPLYVAVVTEIFHLGLDPFLIYGIGPFPAFDVAGAATATTVAEWVGAIWFWKLMMDEEI
LDFQSVFRLPDESNDDLGTLVSGSTSQLARTVLLQTVLVRATSTAAMLGAAGAHQVCLQA
WWVTLFGLDSVAVSAQALVAASLGKNDVPGARIAADRALSWGVGAGVLVGVVVFLSADQL
PYIFTNDAEIAAQAATPIRILSLLQPLNSAVFVGDGVFQGSADFDFLAKAMAISAGGGIL
ALTAAGQMEGASLTSVWLGMATLMFGRAATLGWRYFKDDESPLYVTPFECAVYYDDLPSV
DVDFVDVDAKVSKDETTKPR
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccgacggcccgaccgcgcgcgaccgacgacgcgacggcgcgcgacgcgcggacgcgg
gcgcggcgcacgatcctgggcgtcgatcgagcgaccggggaagcgattccggactgggac
gagtgcgcggagtggcgggcgcgggcgccgccgagcgcggagacgctcgagctgctggac
gcgtcgattttcgcgctcgcgctgccgggcgtggcggagctgctgttggatccggtcatg
ggcgcggtggacacggcgttcatcggaaggctgacgggagacggcgcggcggaggcgctg
ggggggttggcggtgagcacgacgtgctttacgttttgcttcaagttgtttaacttttta
gccgtcgtcacgggaccgctcgtggcggcgaaaatatcggcgagcggggggcgggattcg
gcggaggggcggcgggcggcgaagaagacggtcgggagcgcgatggcgctcgcgctcgcg
ctcgggttcgcgacgatggggatcatggaggttttcacggatgatttattggcgttttgc
ggggcgagtcacgaggcgttgctcaacccgagcgaagatttgcttcccgacgccgacgtg
ccgacgataaaggggatgttggagtacggggaggattacttgcgaattcgcgccgcgtct
ttgcccgcgtgcttgatcgtcatggtgggcgtcggcgcgtttcgcgggttgttggacacg
cggacgccgctctacgtcgccgtcgtcacggaaattttccacctcggcttggatccgttt
ctcatttacggcatcggcccgttcccggcgttcgacgtcgccggcgcggcgacggcgacg
acggtagcggaatgggtcggcgcgatttggttttggaagctcatgatggatgaggagatt
ttagattttcaatccgtctttcgtctgccagacgagtccaacgacgacttgggtacgctc
gtcagcggatcgacgtcgcagctcgcgcgaacggtgcttttacaaaccgtactcgttcgc
gccacgtcgacggcggcgatgctcggcgccgcgggcgcgcatcaagtgtgtttgcaggcg
tggtgggtcacgctgtttggcttggactctgtcgccgtgagcgcgcaggcgttggttgct
gcgagtctcgggaaaaatgacgttcccggcgcgcgcatcgctgccgatcgagcgctgagc
tggggcgtcggcgcgggcgttctcgtcggcgtcgtcgtgttcttgtccgccgatcagttg
ccgtatatattcaccaacgacgccgaaatcgccgcgcaagcggcgacgccgatacgcatc
ttatccctcttgcagccgctcaactccgcggttttcgtcggcgacggcgtgtttcaagga
agcgcggatttcgacttcctcgccaaagccatggctatttccgcgggagggggcatctta
gcgctgacggcggctgggcaaatggaaggcgcttcgctcacgtcggtgtggctggggatg
gcgactttgatgttcggtcgagccgccacgctcggttggcgttatttcaaggacgacgag
tctccactctacgtcacgccattcgagtgcgcggtttactatgacgatttaccgagcgtg
gacgtcgacttcgtcgacgtcgacgcgaaggtttcgaaagacgagacgacgaagccgcga
tga

DBGET integrated database retrieval system