Ostreococcus lucimarinus: OSTLU_33063 Help Entry OSTLU_33063       CDS       T01029                                  Name (RefSeq) predicted protein   KO K17782   mitochondrial intermembrane space import and assembly protein 40 Organism olu  Ostreococcus lucimarinus Brite KEGG Orthology (KO) [BR:olu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:olu03029]     OSTLU_33063   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:olu02000]     OSTLU_33063 Mitochondrial biogenesis [BR:olu03029]  Mitochondrial protein import machinery   Inter membrane space    Mitochondrial intermembrane space assembly (MIA) complex     OSTLU_33063 Transporters [BR:olu02000]  Other transporters   Primary active transporters [TC:3]    OSTLU_33063 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CHCH CX9C GCK Motif Other DBs NCBI-GeneID:  5003297 NCBI-ProteinID:  XP_001419132 JGI:  33063 UniProt:  A4S1D7 LinkDB All DBs Position 8:331985..332248 Genome browser AA seq 87 aa AA seqDB search MAKVKAALACPCVADLRQSSCGTSFDEALTCFMLAKDEEKGKKCVEEFVSLHACMVKNAN EFQEFANELLEHQDVRGPAKATTNAGK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagttaaagccgcactcgcgtgcccgtgcgtggctgatctccgtcaatcttcg tgtggaacgagttttgatgaggcgttgacgtgctttatgctggcgaaagacgaggagaag gggaagaagtgcgtggaggagtttgtgtcgctacacgcgtgcatggtgaagaacgcaaac gagtttcaggagtttgcaaacgagttgttggagcaccaagacgtgcgtggacctgcaaaa gcgacgaccaacgcggggaagtga

DBGET integrated database retrieval system