Ostreococcus lucimarinus: OSTLU_39788 Help Entry OSTLU_39788       CDS       T01029                                  Name (RefSeq) predicted protein   KO K10418   dynein light chain LC8-type Organism olu  Ostreococcus lucimarinus Pathway olu04814   Motor proteins Brite KEGG Orthology (KO) [BR:olu00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     OSTLU_39788  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:olu03037]     OSTLU_39788    04812 Cytoskeleton proteins [BR:olu04812]     OSTLU_39788 Cilium and associated proteins [BR:olu03037]  Motile cilia and associated proteins   Dynein arm    OSTLU_39788 Cytoskeleton proteins [BR:olu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      OSTLU_39788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  4999585 NCBI-ProteinID:  XP_001415389 JGI:  39788 UniProt:  A4RQH4 LinkDB All DBs Position 1:join(94589..94639,94760..94984) Genome browser AA seq 91 aa AA seqDB search MTATKEKAIIKAADMPDDIQDDAVTVSMEAMEKFNVEKDIAAHVKKEFDRKHGPTWHCVV GRNFGSYVTHESGHFIYYYIANVAFLLFKAG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacggcgacgaaggaaaaggccatcatcaaggcggcggacatgccggacgacatccaa gacgacgcggtgacggtgtccatggaggcgatggaaaagttcaacgtcgagaaggacatc gcggcgcacgtgaagaaggaattcgatagaaagcacggcccgacgtggcactgcgtcgtg gggagaaattttggaagttacgtcacgcacgagagcggacacttcatctattactacata gccaacgtcgcgtttttgttgtttaaagcgggctag

DBGET integrated database retrieval system