Ostreococcus lucimarinus: OSTLU_41392 Help Entry OSTLU_41392       CDS       T01029                                  Name (RefSeq) predicted protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism olu  Ostreococcus lucimarinus Pathway olu04145   Phagosome olu04148   Efferocytosis olu04620   Toll-like receptor signaling pathway olu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:olu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     OSTLU_41392    04148 Efferocytosis     OSTLU_41392  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     OSTLU_41392  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     OSTLU_41392  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:olu04131]     OSTLU_41392   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:olu04147]     OSTLU_41392    04031 GTP-binding proteins [BR:olu04031]     OSTLU_41392 Membrane trafficking [BR:olu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     OSTLU_41392  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     OSTLU_41392   Macropinocytosis    Ras GTPases     OSTLU_41392  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     OSTLU_41392 Exosome [BR:olu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    OSTLU_41392   Exosomal proteins of other body fluids (saliva and urine)    OSTLU_41392   Exosomal proteins of colorectal cancer cells    OSTLU_41392   Exosomal proteins of bladder cancer cells    OSTLU_41392 GTP-binding proteins [BR:olu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     OSTLU_41392 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_16 Motif Other DBs NCBI-GeneID:  5002587 NCBI-ProteinID:  XP_001418257 JGI:  41392 UniProt:  A4RZ26 LinkDB All DBs Position 6:489933..490508 Genome browser AA seq 191 aa AA seqDB search MSAHEADHVALKCVVVGDGAVGKTSMLMCYATNTFPTDHMPTIFDNYSKNVRARDGRTVS VGLWDTAGQDEYAAFRPLSYENADAMLLAFSCDSKESYESVETKWAEELRAKAPKTPIVL VCTKIDLRDSGKGVVSRAQGEALGDRIGATAYVECSALTQNGLPAVFDTVIDVHLHPELF EKSKPGCCVVQ NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgcacgaggccgaccacgtggcgctgaagtgcgtcgtcgtcggcgacggtgcg gtcgggaagacgtccatgctgatgtgctacgcgacgaacacgttcccgacggatcacatg ccgacgatttttgataattacagtaaaaacgtgcgcgcgagagacgggcggacggtgagc gtggggctgtgggacaccgctggacaagatgagtacgcggcgtttcgaccgctgagctat gagaacgcggatgcgatgttgttggcgttttcgtgcgattctaaggagagctacgagagc gtggagacgaagtgggcggaggagttgcgcgcgaaggcgccgaagacgcccatcgtgttg gtgtgcaccaagattgatttgcgagacagtgggaaaggggtcgtgagtcgcgcgcaggga gaggcattgggtgatcgaatcggcgcgacggcgtacgtggagtgcagtgcgctgacgcag aatggattgcccgcggtgtttgacaccgtcatagacgtgcacttgcacccagagctgttc gaaaagtcgaagcctggatgctgcgtcgttcaatag

DBGET integrated database retrieval system