Ostreococcus lucimarinus: OSTLU_9233 Help Entry OSTLU_9233        CDS       T01029                                  Name (RefSeq) predicted protein   KO K02183   calmodulin Organism olu  Ostreococcus lucimarinus Pathway olu04016   MAPK signaling pathway - plant olu04070   Phosphatidylinositol signaling system olu04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:olu00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     OSTLU_9233    04070 Phosphatidylinositol signaling system     OSTLU_9233    04075 Plant hormone signal transduction     OSTLU_9233  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:olu01009]     OSTLU_9233   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:olu04131]     OSTLU_9233    03036 Chromosome and associated proteins [BR:olu03036]     OSTLU_9233   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:olu04147]     OSTLU_9233 Protein phosphatases and associated proteins [BR:olu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      OSTLU_9233 Membrane trafficking [BR:olu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     OSTLU_9233 Chromosome and associated proteins [BR:olu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      OSTLU_9233 Exosome [BR:olu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    OSTLU_9233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EH EF-hand_9 SPARC_Ca_bdg EF-hand_10 AIF-1 EF-hand_11 Motif Other DBs NCBI-GeneID:  5004350 NCBI-ProteinID:  XP_001420282 JGI:  9233 UniProt:  A4S4K6 LinkDB All DBs Position 11:<234130..>234354 Genome browser AA seq 75 aa AA seqDB search LTASRIKADRQKGNLRSVFDEIDVNRDGKLCLAEFTQAYKKVDESLTDAQIAKLFRDADV DNSGTLDYDEFCEVM NT seq 225 nt NT seq  +upstreamnt  +downstreamnt ctcacagcttcgaggattaaggcggatagacagaagggtaatttgcgctcggtgttcgac gaaatcgacgtcaaccgcgacggcaaactatgcctcgctgagttcacgcaagcgtacaag aaagtggacgaatcgctcacagacgcacaaatagcgaagcttttccgcgatgcagacgtt gacaacagcggtacattggactacgatgagttttgcgaagtcatg

DBGET integrated database retrieval system