Ostreococcus lucimarinus: OSTLU_9263 Help Entry OSTLU_9263        CDS       T01029                                  Name (RefSeq) predicted protein   KO K20185   biogenesis of lysosome-related organelles complex 1 subunit 1 Organism olu  Ostreococcus lucimarinus Pathway olu04142   Lysosome biogenesis Brite KEGG Orthology (KO) [BR:olu00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome biogenesis     OSTLU_9263  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:olu04131]     OSTLU_9263 Membrane trafficking [BR:olu04131]  Endosome - Lysosome transport   Arf GTPases and associated proteins    BLOC-one-related complex (BORC)     OSTLU_9263   Others    BLOC-1 complex     OSTLU_9263 SSDB OrthologParalogGFIT Motif Pfam:  GCN5L1 ALO DUF1484 Lipoprotein_7 Synaptobrevin Motif Other DBs NCBI-GeneID:  5002008 NCBI-ProteinID:  XP_001417853 JGI:  9263 UniProt:  A4RY21 LinkDB All DBs Position 5:<730861..>731130 Genome browser AA seq 90 aa AA seqDB search RKETVAQVSALADAMTDSVNHGVVEVFENQKQVESSARALNETATAFRERSSEWATSLEA FDKELRDIGDFENWVKAMEHDLATLAAALE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt cgcaaagagaccgtcgcgcaggtgtccgcgctcgcggacgcgatgacggattcggtgaac cacggcgtggttgaggtgtttgagaatcaaaagcaagtcgagtcgtcggcgcgcgcgctg aacgagacggcgacggcgtttcgagagcggtcgagcgagtgggcgacgtcgctggaggcg ttcgataaagagcttagagatatcggggattttgaaaattgggtcaaggcgatggagcac gatttggcgacgttagcggcggcgttggaa

DBGET integrated database retrieval system