Ostreococcus lucimarinus: OSTLU_9279 Help Entry OSTLU_9279        CDS       T01029                                  Name (RefSeq) predicted protein   KO K03671   thioredoxin Organism olu  Ostreococcus lucimarinus Brite KEGG Orthology (KO) [BR:olu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:olu03110]     OSTLU_9279 Chaperones and folding catalysts [BR:olu03110]  Protein folding catalysts   Protein disulfide isomerase    OSTLU_9279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin TraF Thioredoxin_2 TXD17-like_Trx Thioredoxin_8 Motif Other DBs NCBI-GeneID:  5001938 NCBI-ProteinID:  XP_001418111 JGI:  9279 UniProt:  A4RY57 LinkDB All DBs Position 5:complement(<800821..>801063) Genome browser AA seq 81 aa AA seqDB search VVNYGAEWCKHCAKLTPAIDALRERWGGEVAFVDADVDALPFTARAVRWTPTVAFYRNGR LVDECERAKPTQVADRAWLHA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gtcgtcaactacggcgccgagtggtgcaaacactgcgcaaagttgacgcccgcgatcgac gcgctgcgcgagcgctggggcggcgaggtcgcgttcgtggacgcggacgtggacgcgctg ccgttcacggcgcgcgcggtgcgatggacgccgacggtggcgttttacagaaacggacgg ttggtggacgagtgcgagcgagcaaagccgacgcaggtggcggatcgcgcgtggttgcac gcg

DBGET integrated database retrieval system