KEGG   Oenanthe melanoleuca (Eastern black-eared wheatear): 130256471
Entry
130256471         CDS       T09236                                 
Symbol
DIRAS3
Name
(RefSeq) GTP-binding protein Di-Ras3
  KO
K07841  DIRAS family, GTP-binding Ras-like 2
Organism
oma  Oenanthe melanoleuca (Eastern black-eared wheatear)
Brite
KEGG Orthology (KO) [BR:oma00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:oma04031]
    130256471 (DIRAS3)
GTP-binding proteins [BR:oma04031]
 Small (monomeric) G-proteins
  Ras Family
   Di-Ras [OT]
    130256471 (DIRAS3)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU MeaB AAA_24 AAA_16 nSTAND1 SRPRB MMR_HSR1_Xtn AAA_22 NACHT ATPase_2
Other DBs
NCBI-GeneID: 130256471
NCBI-ProteinID: XP_056354121
LinkDB
Position
8:986881..989023
AA seq 198 aa
MPEQSNDYRVVVFGAAGVGKSSLVLRFVRGTFRETYIPTIEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSVTSRQSMEDLHPIFDEICQIKGDIQKIPIMLVG
NKSDDTQRELDASEGQALASKWKCAFMETSAKMNYNVQELFQELLNLEQRRTISLQVDGK
KSKQQKKKDKLQGKCSVM
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcctgagcagagcaatgattacagggtggtggtgttcggagcagcgggggtcggcaaa
agctccctggtcctgcgctttgtaaggggcactttcagggaaacctatatccccaccatc
gaggacacgtaccggcaggtgatcagctgcgacaagagcatctgcaccctgcagatcacg
gacaccacgggcagccatcagttccctgccatgcagcgcctctccatctccaaagggcat
gccttcatcctggtgtactccgtcaccagcaggcaatccatggaagatcttcaccccatc
ttcgatgagatctgccagatcaaaggcgacatccagaaaatccccatcatgttggtgggg
aacaaaagcgacgacacgcagagggagctggatgccagcgaggggcaagcgctggccagc
aagtggaagtgtgccttcatggagacctcggccaaaatgaactacaacgtgcaggagctc
ttccaggagctcttgaacctggagcagaggagaactatcagcctccaggtggatggaaag
aaatccaaacagcagaaaaagaaagataaactgcaaggcaaatgctctgttatgtga

DBGET integrated database retrieval system