Onychostoma macrolepis: 131521510 Help Entry 131521510         CDS       T09350                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism omc  Onychostoma macrolepis Pathway omc04010   MAPK signaling pathway omc04144   Endocytosis omc04370   VEGF signaling pathway omc04510   Focal adhesion omc04520   Adherens junction omc04530   Tight junction omc04810   Regulation of actin cytoskeleton omc04912   GnRH signaling pathway omc05100   Bacterial invasion of epithelial cells omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131521510 (cdc42l)    04370 VEGF signaling pathway     131521510 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131521510 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     131521510 (cdc42l)    04520 Adherens junction     131521510 (cdc42l)    04530 Tight junction     131521510 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131521510 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     131521510 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131521510 (cdc42l)    05100 Bacterial invasion of epithelial cells     131521510 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omc04131]     131521510 (cdc42l)    03036 Chromosome and associated proteins [BR:omc03036]     131521510 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131521510 (cdc42l)    04031 GTP-binding proteins [BR:omc04031]     131521510 (cdc42l) Membrane trafficking [BR:omc04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     131521510 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     131521510 (cdc42l)   Macropinocytosis    Ras GTPases     131521510 (cdc42l) Chromosome and associated proteins [BR:omc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     131521510 (cdc42l) Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of microglial cells    131521510 (cdc42l)   Exosomal proteins of breast milk    131521510 (cdc42l) GTP-binding proteins [BR:omc04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     131521510 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  131521510 NCBI-ProteinID:  XP_058602276 LinkDB All DBs Position 16:13369213..13378915 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggagatggagctgtcggaaagacctgcctcctc atctcatacacaaccaacaaattcccctctgaatatgttcccacggtttttgataactat gctgtcacagtgatgattggaggtgaaccgtatacactggggctttttgacaccgcaggt caggaagactacgacagacttcggcctctcagctatccacagacagacgtcttccttgtt tgcttctctgttgtttctccttcctcctttgagaatgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttctggtgggcactcaggttgacctgagg gatgacagtaacactgtggaaaaacttgccaaaaacaagcagcgccccatatcacccgag agtggggagaagctggccagagacctcagagctgtcaaatacgtggagtgctccgccctc acacagagaggcctgaagaatgtattcgacgaggcgatactcgccgcccttgaacctccg gagaccaaacccaagaagcgctgcgtccttttgtag

DBGET integrated database retrieval system