Onychostoma macrolepis: 131522282 Help Entry 131522282         CDS       T09350                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism omc  Onychostoma macrolepis Pathway omc04068   FoxO signaling pathway omc04136   Autophagy - other omc04140   Autophagy - animal omc04621   NOD-like receptor signaling pathway omc04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     131522282 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131522282 (atg12)    04136 Autophagy - other     131522282 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     131522282 (atg12)    04622 RIG-I-like receptor signaling pathway     131522282 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omc04131]     131522282 (atg12)    04121 Ubiquitin system [BR:omc04121]     131522282 (atg12)    03029 Mitochondrial biogenesis [BR:omc03029]     131522282 (atg12) Membrane trafficking [BR:omc04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     131522282 (atg12) Ubiquitin system [BR:omc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    131522282 (atg12) Mitochondrial biogenesis [BR:omc03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     131522282 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  131522282 NCBI-ProteinID:  XP_058603656 LinkDB All DBs Position 16:20831370..20834731 Genome browser AA seq 120 aa AA seqDB search MSDNAESPTENQKDDPSIQHTATEHTGASDEKKKIDVLLKAVGDTPIMKTKKWSVERGRT VQSLAQFISRFLKLEPSEQLFIYVNQSFAPSPDQEVGALFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagaatctcctacagaaaatcaaaaagatgatccttcgatacaacac actgctactgaacacactggagcgtcggatgagaagaaaaagattgatgtgctgttgaaa gcagtaggtgatacgcctatcatgaagaccaaaaaatggtccgtggaaagagggaggaca gtacagtcactcgctcagtttatctcacgctttctcaaactggagcctagtgaacaactg ttcatttatgtcaatcagtcatttgctccatcaccagaccaagaagtgggtgcacttttc gagtgttttggaagtgatggaaaactagttctccattactgcaagtcccaggcctgggga tga

DBGET integrated database retrieval system