Onychostoma macrolepis: 131524967 Help Entry 131524967         CDS       T09350                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism omc  Onychostoma macrolepis Brite KEGG Orthology (KO) [BR:omc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:omc03019]     131524967 (mt2)    03029 Mitochondrial biogenesis [BR:omc03029]     131524967 (mt2) Messenger RNA biogenesis [BR:omc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      131524967 (mt2) Mitochondrial biogenesis [BR:omc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     131524967 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  131524967 NCBI-ProteinID:  XP_058608417 LinkDB All DBs Position 18:10761871..10762722 Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGTCNCGTTCKCTNCQCTTCKKSCCPCCPSGCSKCASGCVCKGNSCGSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgattgcgccaagactggaacttgcaactgtggtaccacctgcaagtgc actaattgccagtgtacaacctgcaagaagagctgctgtccctgctgcccgtctggttgc agcaagtgcgcctctggctgcgtgtgtaagggcaactcctgcggctccagctgctgtcag tga

DBGET integrated database retrieval system