Onychostoma macrolepis: 131525722 Help Entry 131525722         CDS       T09350                                  Symbol psmb12 Name (RefSeq) proteasome 20S subunit beta 12   KO K02738   20S proteasome subunit beta 1 [EC:3.4.25.1] Organism omc  Onychostoma macrolepis Pathway omc03050   Proteasome Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     131525722 (psmb12)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:omc01002]     131525722 (psmb12)   09182 Protein families: genetic information processing    03051 Proteasome [BR:omc03051]     131525722 (psmb12) Enzymes [BR:omc01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      131525722 (psmb12) Peptidases and inhibitors [BR:omc01002]  Threonine peptidases   Family T1: proteasome family    131525722 (psmb12) Proteasome [BR:omc03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     131525722 (psmb12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome SCRE Motif Other DBs NCBI-GeneID:  131525722 NCBI-ProteinID:  XP_058609616 LinkDB All DBs Position 19:complement(27745308..27747542) Genome browser AA seq 127 aa AA seqDB search MDRHHSHAQVKGVSTGTTILAVKFNGGVIIGSDSRASMGESYVSSKTINKLIQVHDRIFC CIAGSLADAQAVTKMAKFQLSFHSIQMESPPLVKAAASIMRELCYSNKEELQAGFITAGW DRKKDHR NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggacaggcatcattcacacgcacaagtaaaaggtgtcagcaccggcaccaccattctt gctgttaagttcaatggaggagttatcattgggtctgactcgagagcttctatgggagaa tcttatgtgtcttccaaaaccatcaacaagctgatccaggtgcatgatagaatattttgc tgcatagctggatcactggcagatgcacaagctgttaccaaaatggccaaattccagctg tcttttcacagtattcagatggaatctcctcctttggtaaaagccgcagcatccatcatg agggaactttgctatagtaataaggaagagctgcaggcgggcttcatcacagcgggctgg gacaggaagaaggaccacaggtga

DBGET integrated database retrieval system