Onychostoma macrolepis: 131525945 Help Entry 131525945         CDS       T09350                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism omc  Onychostoma macrolepis Pathway omc04382   Cornified envelope formation omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     131525945 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131525945 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131525945 (s100a10a) Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of microglial cells    131525945 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  131525945 NCBI-ProteinID:  XP_058609941 LinkDB All DBs Position 19:complement(23544606..23545651) Genome browser AA seq 101 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGKSGTLTRRELRTLMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKKTQSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatccgaactagagaccgccatggagtccctcatcatggtattccaccgctacgct ggaaaagagggcaagagcggcaccctgacccgccgtgaactccgaaccctgatggagaac gagctctctgggtttctcaagtctcagaaggatccaactaccatagacagaattatgaag gacttggatgccaatggagatggggaggtgaactttgaggagtttgtgtctttggttgtg ggtttatccatcgcttgtgaggcgtgctatagaatgcagttaaagaagacacagagctgg aaatga

DBGET integrated database retrieval system