Onychostoma macrolepis: 131528633 Help Entry 131528633         CDS       T09350                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism omc  Onychostoma macrolepis Pathway omc04814   Motor proteins omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     131528633 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131528633 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:omc03037]     131528633 (dynll2b)    04812 Cytoskeleton proteins [BR:omc04812]     131528633 (dynll2b) Cilium and associated proteins [BR:omc03037]  Motile cilia and associated proteins   Dynein arm    131528633 (dynll2b) Cytoskeleton proteins [BR:omc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131528633 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Nop Ectatomin Motif Other DBs NCBI-GeneID:  131528633 NCBI-ProteinID:  XP_058613902 LinkDB All DBs Position 21:6313487..6317682 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaacgctgatatgtccgaggacatgcagcaggat gcagtggattgtgccacgcaggccatggagaagtacaacattgagaaggacattgctgca tatatcaaaaaggagttcgataagaagtataatccgacatggcattgtattgtgggacgg aactttggcagttatgtgacgcacgaaactaagcatttcatctacttttacttgggtcaa gtggccattctgctcttcaaatcaggctga

DBGET integrated database retrieval system