Onychostoma macrolepis: 131528633 Help Entry 131528633         CDS       T09350                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism omc  Onychostoma macrolepis Pathway omc04517   IgSF CAM signaling omc04814   Motor proteins omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131528633 (dynll2b)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     131528633 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131528633 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:omc03037]     131528633 (dynll2b)    04812 Cytoskeleton proteins [BR:omc04812]     131528633 (dynll2b) Cilium and associated proteins [BR:omc03037]  Motile cilia and associated proteins   Dynein arm    131528633 (dynll2b) Cytoskeleton proteins [BR:omc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131528633 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  131528633 NCBI-ProteinID:  XP_058613902 LinkDB All DBs Position 21:6313487..6317682 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaataaagaacgctgatatgtccgaggacatgcagcaggat gcagtggattgtgccacgcaggccatggagaagtacaacattgagaaggacattgctgca tatatcaaaaaggagttcgataagaagtataatccgacatggcattgtattgtgggacgg aactttggcagttatgtgacgcacgaaactaagcatttcatctacttttacttgggtcaa gtggccattctgctcttcaaatcaggctga

DBGET integrated database retrieval system