Onychostoma macrolepis: 131532062 Help Entry 131532062         CDS       T09350                                  Name (RefSeq) histone H2B.1, sperm-like   KO K11252   histone H2B Organism omc  Onychostoma macrolepis Brite KEGG Orthology (KO) [BR:omc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:omc03036]     131532062   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131532062 Chromosome and associated proteins [BR:omc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131532062 Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131532062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  131532062 NCBI-ProteinID:  XP_058619385 LinkDB All DBs Position 23:complement(3209407..3209890) Genome browser AA seq 93 aa AA seqDB search MKTSSDRRPRSLKTSRRTGWTRKRSTEAYSAYIYKIEKELSEVSDTVALMRHLSDAHAQM GAEAARLSKFNRRGVITQRELHTAAKKLLTAEI NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaaacctcatctgaccggagaccgagatccctgaagacgtccaggagaaccggctgg acgcgcaaacggagcaccgaggcgtattcagcttacatttacaagatcgagaaggagctg agtgaagtgagtgacaccgtggctttgatgcggcacctgtccgacgcgcatgcgcagatg ggcgccgaggccgcgcggctctccaagttcaaccggcgaggcgtcatcacccagcgagag ctccacaccgccgccaaaaagctcctgacggctgagatttaa

DBGET integrated database retrieval system