Onychostoma macrolepis: 131534047 Help Entry 131534047         CDS       T09350                                  Symbol hrasa Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism omc  Onychostoma macrolepis Pathway omc04010   MAPK signaling pathway omc04012   ErbB signaling pathway omc04068   FoxO signaling pathway omc04137   Mitophagy - animal omc04140   Autophagy - animal omc04144   Endocytosis omc04150   mTOR signaling pathway omc04210   Apoptosis omc04218   Cellular senescence omc04370   VEGF signaling pathway omc04371   Apelin signaling pathway omc04510   Focal adhesion omc04540   Gap junction omc04625   C-type lectin receptor signaling pathway omc04810   Regulation of actin cytoskeleton omc04910   Insulin signaling pathway omc04912   GnRH signaling pathway omc04916   Melanogenesis omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131534047 (hrasa)    04012 ErbB signaling pathway     131534047 (hrasa)    04370 VEGF signaling pathway     131534047 (hrasa)    04371 Apelin signaling pathway     131534047 (hrasa)    04068 FoxO signaling pathway     131534047 (hrasa)    04150 mTOR signaling pathway     131534047 (hrasa)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131534047 (hrasa)    04140 Autophagy - animal     131534047 (hrasa)    04137 Mitophagy - animal     131534047 (hrasa)   09143 Cell growth and death    04210 Apoptosis     131534047 (hrasa)    04218 Cellular senescence     131534047 (hrasa)   09144 Cellular community - eukaryotes    04510 Focal adhesion     131534047 (hrasa)    04540 Gap junction     131534047 (hrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131534047 (hrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131534047 (hrasa)   09152 Endocrine system    04910 Insulin signaling pathway     131534047 (hrasa)    04912 GnRH signaling pathway     131534047 (hrasa)    04916 Melanogenesis     131534047 (hrasa)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131534047 (hrasa)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omc04131]     131534047 (hrasa)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131534047 (hrasa)    04031 GTP-binding proteins [BR:omc04031]     131534047 (hrasa) Membrane trafficking [BR:omc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     131534047 (hrasa)  Endocytosis   Macropinocytosis    Ras GTPases     131534047 (hrasa) Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    131534047 (hrasa)   Exosomal proteins of colorectal cancer cells    131534047 (hrasa) GTP-binding proteins [BR:omc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     131534047 (hrasa) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  131534047 NCBI-ProteinID:  XP_058622656 LinkDB All DBs Position 25:complement(20519492..20545505) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggtgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgatggggagacgtgtctcctggacatcttggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggagagggcttcctctgt gtctttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc aaacgggtaaaggactcggatgacgtgcccatggtgctggtgggtaacaaatgcgacctc ccggcccggacggtggacacacggcaagcgcaggagctcgcgcgcagctacgggatcccc ttcatcgagacctcagccaaaacacgacagggtgtggaggacgcgttttacacgctggtg cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggacaggac tgcatgagctgccgctgcgtcgtgtcgtga

DBGET integrated database retrieval system