Onychostoma macrolepis: 131536517 Help Entry 131536517         CDS       T09350                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism omc  Onychostoma macrolepis Brite KEGG Orthology (KO) [BR:omc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:omc03041]     131536517 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omc04052]     131536517 (ubl5) Spliceosome [BR:omc03041]  Complex B   Other components    Complex B specific factors     131536517 (ubl5) Cytokines and neuropeptides [BR:omc04052]  Neuropeptides   Unclassified    131536517 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  131536517 NCBI-ProteinID:  XP_058625488 LinkDB All DBs Position 01:2516603..2522042 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNQEDTIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtctgtaatgatcgtctggggaagaaggttcgggtcaaatgcaatcag gaggacacgatcggagacctgaagaagctgatcgcagcgcagaccggcactcggtgggac aagatcgtgctcaagaaatggtacaccatattcaaggaccacgtgtcactgggagactat gaaatccatgacggcatgaacctcgagctctattaccagtag

DBGET integrated database retrieval system