Onychostoma macrolepis: 131537712 Help Entry 131537712         CDS       T09350                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism omc  Onychostoma macrolepis Pathway omc04010   MAPK signaling pathway omc04137   Mitophagy - animal omc04140   Autophagy - animal omc04218   Cellular senescence omc04371   Apelin signaling pathway omc04625   C-type lectin receptor signaling pathway omc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131537712 (rras)    04371 Apelin signaling pathway     131537712 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131537712 (rras)    04137 Mitophagy - animal     131537712 (rras)   09143 Cell growth and death    04218 Cellular senescence     131537712 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131537712 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131537712 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131537712 (rras)    04031 GTP-binding proteins [BR:omc04031]     131537712 (rras) Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131537712 (rras)   Exosomal proteins of bladder cancer cells    131537712 (rras) GTP-binding proteins [BR:omc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     131537712 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  131537712 NCBI-ProteinID:  XP_058627318 LinkDB All DBs Position 03:complement(35900013..35904184) Genome browser AA seq 196 aa AA seqDB search MSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILD TAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYDEIQKFHTQILRVKDRDDFPMVLVGNK SDLDQQRVISRDEAMSFAQENRIHYMESSAKNRHNVDEAFVEVVRAIRKFQETESPPLPS NHAGKQKSGGCPCTLL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgaagaaagatataagttggtggtcgtgggaggtggtggtgtggggaaaagc gccctcactattcagttcattcagtcatactttgtgtcggactatgacccaaccattgaa gactcgtacactaaaatctgcaccgtggatggaaaggagacacgattagacatcctcgac acagcaggacaagaagagtttggagcgatgagagagcagtacatgcgctccggagagggt ttcttactggtgtttgctcttaatgacagtggcagttatgatgaaattcagaaatttcac actcagatattgcgggtgaaggatcgagatgactttcctatggttcttgttggcaacaaa tcagatcttgaccagcagagagtgatctcaagagatgaggccatgtcgtttgcccaagaa aacaggatccactatatggaatcgtcagctaagaaccgccacaatgtggatgaagccttc gtggaggttgtgcgagcaataaggaagtttcaggagacagagagtccaccgctcccctct aatcacgctgggaagcagaagagtggtggctgtccctgcaccctgctctga

DBGET integrated database retrieval system