Onychostoma macrolepis: 131537713 Help Entry 131537713         CDS       T09350                                  Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism omc  Onychostoma macrolepis Pathway omc04010   MAPK signaling pathway omc04068   FoxO signaling pathway omc04081   Hormone signaling omc04114   Oocyte meiosis omc04140   Autophagy - animal omc04150   mTOR signaling pathway omc04810   Regulation of actin cytoskeleton omc04910   Insulin signaling pathway omc04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     131537713    04150 mTOR signaling pathway     131537713   09133 Signaling molecules and interaction    04081 Hormone signaling     131537713  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131537713  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omc04052]     131537713 Cytokines and neuropeptides [BR:omc04052]  Neuropeptides   Unclassified    131537713 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  131537713 NCBI-ProteinID:  XP_058627320 LinkDB All DBs Position 03:complement(35859236..35864863) Genome browser AA seq 124 aa AA seqDB search MKRRDFLISRMQRSGLLLLSLCAGSLVTHSGAFGNRRLCGIHLVEALLLVCGEKGLFYQP GRRIREHTFRVMMRNSAPFLGLTGAAAQSGDRGTARNTVAKRGIVEQCCHFYCDYYDLEN YCNT NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgaaacggagagattttctcataagcagaatgcagagatctggattgctcctgctgtcg ctgtgtgccggctctctggtgacccacagcggcgcgtttgggaatcgaaggctgtgcggg attcatctcgtggaagcgctgctgctcgtctgtggtgaaaagggcctcttctaccagcct ggcaggcgtatcagagagcacactttccgcgtcatgatgaggaacagcgcccccttcctg gggctcactggagcggctgctcagagtggagacagaggcactgccagaaacactgttgca aagagaggcattgtggagcagtgctgtcatttctactgtgactattacgacctggagaat tactgtaacacatag

DBGET integrated database retrieval system