Onychostoma macrolepis: 131538352 Help Entry 131538352         CDS       T09350                                  Symbol dynlt1b Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism omc  Onychostoma macrolepis Pathway omc04814   Motor proteins omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     131538352 (dynlt1b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131538352 (dynlt1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:omc03037]     131538352 (dynlt1b)    04812 Cytoskeleton proteins [BR:omc04812]     131538352 (dynlt1b) Cilium and associated proteins [BR:omc03037]  Motile cilia and associated proteins   Dynein arm    131538352 (dynlt1b) Cytoskeleton proteins [BR:omc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131538352 (dynlt1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Gag_FV_central Motif Other DBs NCBI-GeneID:  131538352 NCBI-ProteinID:  XP_058628168 LinkDB All DBs Position 04:complement(35961617..35965308) Genome browser AA seq 113 aa AA seqDB search MDDDQSAEETAFVVEEVSSIVKESLEAVIGRNPYEHKRVNQWMSSVVEQCLGQLSKLGKP FKYIVTCIIMQKNGAGLQSASSCFWDNTTDGSCTVRWENKHLYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacgatcagagcgcggaggagacggcgttcgtggtggaagaagtgagcagcatc gtgaaggagtctctggaggctgtgatcggcagaaacccgtacgaacacaagcgtgtgaac cagtggatgtccagcgtggtggagcagtgcctcggtcagctcagcaaactcggcaaaccc ttcaaatacatcgtcacatgcattataatgcagaagaacggcgcaggactgcagtcggct tcttcatgtttctgggacaatactacagatggcagctgcacggtccgatgggaaaacaaa cacctgtactgcatcgtcagtgtgttcggactcgccatctag

DBGET integrated database retrieval system