Onychostoma macrolepis: 131541818 Help Entry 131541818         CDS       T09350                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism omc  Onychostoma macrolepis Pathway omc04060   Cytokine-cytokine receptor interaction omc04218   Cellular senescence omc04620   Toll-like receptor signaling pathway omc04621   NOD-like receptor signaling pathway omc04622   RIG-I-like receptor signaling pathway omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131541818  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     131541818  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131541818    04621 NOD-like receptor signaling pathway     131541818    04622 RIG-I-like receptor signaling pathway     131541818  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131541818  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omc04052]     131541818    00536 Glycosaminoglycan binding proteins [BR:omc00536]     131541818 Cytokines and neuropeptides [BR:omc04052]  Cytokines   Chemokines    131541818 Glycosaminoglycan binding proteins [BR:omc00536]  Heparan sulfate / Heparin   Chemokines    131541818 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  131541818 NCBI-ProteinID:  XP_058633754 LinkDB All DBs Position 01:complement(36242134..36243518) Genome browser AA seq 98 aa AA seqDB search MHCKIFLVSVIVFLGFLTIGEGMSLKGLGVDPRCRCIETESRRIGKHIESVELFPPSSHC KDTEIIATLKGSGKEICLDPTAPWVKKVIEKIIANKAP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcactgcaaaatctttttagtctctgttattgttttcctcggattcctgaccattggt gaaggaatgagtcttaaaggtctgggtgtagatccacgctgtcgctgcattgaaactgag agtcgacgcattggaaaacacattgagagtgtggagctcttccctccaagctcacactgt aaagacacagagatcattgccaccctgaagggatctgggaaagagatctgtctggaccct actgcaccctgggttaagaaggtcattgagaagatcattgccaacaaagccccatga

DBGET integrated database retrieval system