Onychostoma macrolepis: 131542983 Help Entry 131542983         CDS       T09350                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism omc  Onychostoma macrolepis Pathway omc03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     131542983 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:omc03036]     131542983 (cenps)    03400 DNA repair and recombination proteins [BR:omc03400]     131542983 (cenps) Chromosome and associated proteins [BR:omc03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      131542983 (cenps) DNA repair and recombination proteins [BR:omc03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      131542983 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa ZapG-like Bromo_TP TAF Motif Other DBs NCBI-GeneID:  131542983 NCBI-ProteinID:  XP_058636107 LinkDB All DBs Position 06:26554034..26555488 Genome browser AA seq 127 aa AA seqDB search MDEDAAQKQRLKAAVHYTVGRLCQDISADCEKQITKQTIAAIAETAFRQCDIFAKDLEAF ARHAKRHTVTVDDVKLTARRTTALYNYIQQKSEELALNNQELKEKRKKNAAKRKSKDMEV EENELED NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggatgaggacgcggcacaaaaacagaggcttaaagctgctgtgcactacactgtcggc cgtctctgtcaagatatctctgcagactgcgagaaacaaatcaccaaacagacaatagca gctattgcagagactgcgttcagacagtgcgatatatttgccaaggacttagaagcgttt gcgaggcatgctaaaagacacacagttacagtggatgatgtgaagctaacagcgaggaga accactgcattgtacaactacattcagcagaaaagtgaagaactggctttaaacaaccaa gaactgaaggagaagaggaagaagaatgctgccaagaggaagagtaaagacatggaagtg gaggagaatgagcttgaagactaa

DBGET integrated database retrieval system