Onychostoma macrolepis: 131544317 Help Entry 131544317         CDS       T09350                                  Symbol txn Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism omc  Onychostoma macrolepis Pathway omc04621   NOD-like receptor signaling pathway omc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:omc00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     131544317 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131544317 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:omc03110]     131544317 (txn) Chaperones and folding catalysts [BR:omc03110]  Protein folding catalysts   Protein disulfide isomerase    131544317 (txn) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin DIM1 OST3_OST6 Thioredoxin_8 Redoxin AhpC-TSA Thioredoxin_7 Thioredoxin_9 Thioredoxin_2 Motif Other DBs NCBI-GeneID:  131544317 NCBI-ProteinID:  XP_058638433 LinkDB All DBs Position 07:34611892..34615434 Genome browser AA seq 107 aa AA seqDB search MIIIIEDKSAFDNALKIAGNKLVVVDFTATWCGPCQNIAPIFKTLSEKQDNGNVVFLKVD VDDAQDVATYCDIKCMPTFHFYKNGMKIDEFAGSNHTKLEEKINMHK NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgattatcataattgaggataagtctgcctttgacaatgctctgaaaatcgccgggaac aagttggtggtggtggacttcacagccacatggtgcgggccctgccaaaacatcgctcca atctttaaaacgctgtctgaaaaacaagacaacggaaatgttgtgtttctaaaggtggat gtggatgatgcacaggatgtggccacttactgtgacatcaaatgtatgccaacattccat ttctacaagaatggaatgaagattgatgaatttgctggatcaaatcacactaagctggag gagaagatcaatatgcataaatga

DBGET integrated database retrieval system