Onychostoma macrolepis: 131548355 Help Entry 131548355         CDS       T09350                                  Name (RefSeq) histone H2A-beta, sperm-like   KO K11251   histone H2A Organism omc  Onychostoma macrolepis Pathway omc03082   ATP-dependent chromatin remodeling omc04217   Necroptosis Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     131548355  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131548355  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:omc03036]     131548355   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131548355 Chromosome and associated proteins [BR:omc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131548355 Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131548355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  131548355 NCBI-ProteinID:  XP_058645580 LinkDB All DBs Position 10:7428433..7430018 Genome browser AA seq 107 aa AA seqDB search MKRKTKPATNLPSRAGLVFPVQRVQQTFIAGKLPGTIDKEAAVFLAGVLEFLVAEILTLA GQDAALNQSNKITLHHLPGLQDKKRYAKLLELSKEKKRNTMRRKRSV NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaagaggaagacgaagcccgccacgaatctgccttcacgagcaggtctcgtgtttccc gtccagcgcgttcagcaaactttcatcgccggaaagctgccggggacaatcgacaaggaa gcggcggtgtttctcgcaggtgtgctggagttccttgtggccgagatcctgactttggcg gggcaagatgctgcactcaatcagtcgaataagatcacattacaccatcttcctggactg caggacaaaaagagatacgcaaagttgttggaactgtctaaagaaaaaaaaaggaatacg atgaggaggaagcggtcggtgtag

DBGET integrated database retrieval system