Onychostoma macrolepis: 131550864 Help Entry 131550864         CDS       T09350                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism omc  Onychostoma macrolepis Pathway omc04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     131550864  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:omc04121]     131550864    03400 DNA repair and recombination proteins [BR:omc03400]     131550864 Ubiquitin system [BR:omc04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      131550864    Cul5 complex      131550864 DNA repair and recombination proteins [BR:omc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      131550864 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  131550864 NCBI-ProteinID:  XP_058649309 LinkDB All DBs Position 12:complement(20687035..20690373) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRSPEEQRLYKDEQPLEDNKTLGDC GFTNQTARPQAPATVGLAFRISDDTFEHQQVEPFSCPPELPDVMKPQDSGSTANEQSVM NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtattcttaatgatcaggcgtcacaaaaccacaatcttcacagacgccaaagaa tccacaaccgtctatgagttgaaacgaattgtggagggcatcctgaagaggtcccccgag gaacagagactatacaaggatgagcagcctctagaagacaataagacactaggagactgt ggcttcacgaatcagacagccagaccacaggctcctgcgactgtaggactggcctttcgt atcagtgatgatacatttgagcaccagcaggtggaaccattttcctgtcctcctgaactt cctgatgttatgaagccacaggactctggcagtacagccaatgaacagtcagtgatgtga

DBGET integrated database retrieval system