Oleiphilus messinensis: OLMES_0114 Help Entry OLMES_0114        CDS       T04860                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism ome  Oleiphilus messinensis Pathway ome00290   Valine, leucine and isoleucine biosynthesis ome00650   Butanoate metabolism ome00660   C5-Branched dibasic acid metabolism ome00770   Pantothenate and CoA biosynthesis ome01100   Metabolic pathways ome01110   Biosynthesis of secondary metabolites ome01210   2-Oxocarboxylic acid metabolism ome01230   Biosynthesis of amino acids Module ome_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ome_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ome00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     OLMES_0114    00660 C5-Branched dibasic acid metabolism     OLMES_0114   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     OLMES_0114   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     OLMES_0114 Enzymes [BR:ome01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      OLMES_0114 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Cdc6_C ACT_AHAS_ss Motif Other DBs NCBI-ProteinID:  ARU54223 UniProt:  A0A1Y0I4A2 LinkDB All DBs Position complement(118336..118587) Genome browser AA seq 83 aa AA seqDB search MNEYRIFCQFTPAPAALERILRTTRVRGFTIGKLEATVSESGMNLEMNVQGNRDVCNLLK QLDKLQEVSETGQRQGVPHKKTA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaatgaataccgcattttttgccaatttacgcccgccccggcggcgttggaacgcata ctgagaacaacacgggttcgcggttttacgatcggtaaacttgaagcgacagtatccgaa agtggaatgaatctggagatgaatgttcaaggtaaccgggatgtttgcaatctgctcaag cagctcgataaattgcaggaagtttccgaaaccggacaacgtcagggtgttccacacaag aaaacggcttga

DBGET integrated database retrieval system