Oleiphilus messinensis: OLMES_0991 Help Entry OLMES_0991        CDS       T04860                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism ome  Oleiphilus messinensis Brite KEGG Orthology (KO) [BR:ome00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ome03036]     OLMES_0991 Chromosome and associated proteins [BR:ome03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OLMES_0991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Nore1-SARAH Sas-6_C_CC Shugoshin_N CC142_N EAD7 DivIC Motif Other DBs NCBI-ProteinID:  ARU55077 UniProt:  A0A1Y0I3M8 LinkDB All DBs Position complement(1106917..1107123) Genome browser AA seq 68 aa AA seqDB search MEEMTLQTLSAKIDTLVGYCEQLQADNVALRALQEEWHRERAQLMQKNDLARNKIEAMIG RLKALEQK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaagaaatgacattacaaacattatccgccaaaatagacacgcttgtgggctattgt gagcagctacaagcggacaacgtcgcactgcgggcactgcaggaagaatggcacagggaa agagcacaactaatgcaaaaaaatgatcttgcccgaaacaaaatcgaagcgatgataggc agattgaaagcactggagcaaaagtga

DBGET integrated database retrieval system