Oleiphilus messinensis: OLMES_1033 Help Entry OLMES_1033        CDS       T04860                                  Name (GenBank) acyl carrier protein (ACP2)   KO K02078   acyl carrier protein Organism ome  Oleiphilus messinensis Pathway ome01100   Metabolic pathways ome01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ome00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OLMES_1033    00074 Mycolic acid biosynthesis     OLMES_1033   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OLMES_1033 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARU55119 UniProt:  A0A1Y0I4I5 LinkDB All DBs Position complement(1150289..1150537) Genome browser AA seq 82 aa AA seqDB search MENKEQIYSTLKTVLIDEFDLDAEDITPQASLFEDLDLDSIDAVDLAVKIRELTGKKIDP EQFKSVRTLQDVVDCTAELLGL NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaaaacaaggaacagatttacagcacactgaaaacggtgctgattgacgagtttgac ctggacgcagaagacattacaccgcaagcatcgctgtttgaagaccttgacctggacagc atcgatgcagtggatttagcggttaaaattcgggaacttaccggaaaaaagatcgaccca gagcaattcaaatcggttcggacattacaagatgttgtagactgtactgctgaattgctg gggctttag

DBGET integrated database retrieval system