Oleiphilus messinensis: OLMES_1034 Help Entry OLMES_1034        CDS       T04860                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ome  Oleiphilus messinensis Pathway ome01100   Metabolic pathways ome01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ome00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OLMES_1034    00074 Mycolic acid biosynthesis     OLMES_1034   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OLMES_1034 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARU55120 UniProt:  A0A1Y0I4F2 LinkDB All DBs Position complement(1150544..1150807) Genome browser AA seq 87 aa AA seqDB search MEQLKNEIKELIIQTLDLEDTSPEDIVDDEPLFIEGLGLDSIDALELGLAIKKSYNIKLD PDSEVAKQHFASVNSLASFVKANFKSE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaacaattgaaaaacgaaatcaaagaattgattatccaaactctggatcttgaagac acctcccctgaagatattgttgatgatgaaccactgttcatcgaaggactgggtttagac tcgattgacgcactggaactggggttggcgattaagaaatcttacaatatcaaactggat cccgactcagaggttgcaaaacagcactttgcctcagttaattccctggcaagttttgtc aaagccaacttcaaatcagagtaa

DBGET integrated database retrieval system