Oleiphilus messinensis: OLMES_3769 Help Entry OLMES_3769        CDS       T04860                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ome  Oleiphilus messinensis Pathway ome01100   Metabolic pathways ome01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ome00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OLMES_3769    00074 Mycolic acid biosynthesis     OLMES_3769   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OLMES_3769 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ARU57790 UniProt:  A0A1Y0IC17 LinkDB All DBs Position complement(4274638..4274877) Genome browser AA seq 79 aa AA seqDB search MSDMFEQVKKVICEQLDIEPEQVTPEARFIEDLGADSLDTVELVMAFEEEFDVEIPEDQA EKIQSVQDVLDLVAEAVAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcagatatgtttgagcaagtgaaaaaagtgatttgtgagcaactggatattgaacca gagcaagtgacgcctgaagctcgttttatcgaagatttgggtgcagactcgttggacact gtcgagttggtcatggcgttcgaagaagagtttgatgtggaaattccagaggatcaagca gagaaaatccagtcggttcaagacgtgctggatcttgttgcagaagcggttgcagcttaa

DBGET integrated database retrieval system